Loading ...
Sorry, an error occurred while loading the content.

Sending a boolean?

Expand Messages
  • deandp357
    Hi, I m having trouble sending a simple boolean across using SOAP-Lite-0.67. My client call is: $result = $bs- submitSingleQuery( 10, # alignment
    Message 1 of 3 , May 18 1:52 PM
    • 0 Attachment
      Hi, I'm having trouble sending a simple boolean across using
      SOAP-Lite-0.67. My client call is:

      $result = $bs->submitSingleQuery(
      10, # alignment limit
      "", # blast options
      "genebookp", # databaseName
      10, # descripton limit
      "false", # filter opt
      0, # priority
      "perl", # search name
      "false", # do html
      "hsstromr", # seq name
      "protein", # seq type
      $QSEQ # sequence
      );

      But here's what the Axis server is receiving, as reported by the
      SOAPMonitor utility:

      <?xml version="1.0" encoding="utf-8"?>
      <soap:Envelope
      soap:encodingStyle="http://schemas.xmlsoap.org/soap/encoding/"
      xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance"
      xmlns:soapenc="http://schemas.xmlsoap.org/soap/encoding/"
      xmlns:xsd="http://www.w3.org/2001/XMLSchema"
      xmlns:soap="http://schemas.xmlsoap.org/soap/envelope/">
      <soap:Body>
      <submitSingleQuery xmlns="urn:blastservice">
      <c-gensym3 xsi:type="xsd:int">10</c-gensym3>
      <c-gensym5 xsi:type="xsd:string"/>
      <c-gensym7 xsi:type="xsd:string">genebookp</c-gensym7>
      <c-gensym9 xsi:type="xsd:int">10</c-gensym9>
      <c-gensym11 xsi:type="xsd:boolean">true</c-gensym11>
      <c-gensym13 xsi:type="xsd:int">0</c-gensym13>
      <c-gensym15 xsi:type="xsd:string">perl</c-gensym15>
      <c-gensym17 xsi:type="xsd:boolean">true</c-gensym17>
      <c-gensym19 xsi:type="xsd:string">hsstromr</c-gensym19>
      <c-gensym21 xsi:type="xsd:string">protein</c-gensym21>
      <c-gensym23 xsi:type="xsd:string">
      >hsstromr
      MKSLPILLLLCVAVCSAYPLDGAARGEDTSMNLVQKYLENYYDL
      </c-gensym23>
      </submitSingleQuery>
      </soap:Body>
      </soap:Envelope>

      Thus 'false' is always sent as 'true', and 'true' results in 'true'
      being sent. Is there something simple I'm missing?

      Thanks!
      David
    • Eric Bridger
      I d try sending 0 or a null string .
      Message 2 of 3 , May 18 2:39 PM
      • 0 Attachment
        I'd try sending 0 or a null string ''.

        On Thu, 2006-05-18 at 16:52, deandp357 wrote:
        > Hi, I'm having trouble sending a simple boolean across using
        > SOAP-Lite-0.67. My client call is:
        >
        > $result = $bs->submitSingleQuery(
        > 10, # alignment limit
        > "", # blast options
        > "genebookp", # databaseName
        > 10, # descripton limit
        > "false", # filter opt
        > 0, # priority
        > "perl", # search name
        > "false", # do html
        > "hsstromr", # seq name
        > "protein", # seq type
        > $QSEQ # sequence
        > );
        >
        > But here's what the Axis server is receiving, as reported by the
        > SOAPMonitor utility:
        >
        > <?xml version="1.0" encoding="utf-8"?>
        > <soap:Envelope
        > soap:encodingStyle="http://schemas.xmlsoap.org/soap/encoding/"
        > xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance"
        > xmlns:soapenc="http://schemas.xmlsoap.org/soap/encoding/"
        > xmlns:xsd="http://www.w3.org/2001/XMLSchema"
        > xmlns:soap="http://schemas.xmlsoap.org/soap/envelope/">
        > <soap:Body>
        > <submitSingleQuery xmlns="urn:blastservice">
        > <c-gensym3 xsi:type="xsd:int">10</c-gensym3>
        > <c-gensym5 xsi:type="xsd:string"/>
        > <c-gensym7 xsi:type="xsd:string">genebookp</c-gensym7>
        > <c-gensym9 xsi:type="xsd:int">10</c-gensym9>
        > <c-gensym11 xsi:type="xsd:boolean">true</c-gensym11>
        > <c-gensym13 xsi:type="xsd:int">0</c-gensym13>
        > <c-gensym15 xsi:type="xsd:string">perl</c-gensym15>
        > <c-gensym17 xsi:type="xsd:boolean">true</c-gensym17>
        > <c-gensym19 xsi:type="xsd:string">hsstromr</c-gensym19>
        > <c-gensym21 xsi:type="xsd:string">protein</c-gensym21>
        > <c-gensym23 xsi:type="xsd:string">
        > >hsstromr
        > MKSLPILLLLCVAVCSAYPLDGAARGEDTSMNLVQKYLENYYDL
        > </c-gensym23>
        > </submitSingleQuery>
        > </soap:Body>
        > </soap:Envelope>
        >
        > Thus 'false' is always sent as 'true', and 'true' results in 'true'
        > being sent. Is there something simple I'm missing?
        >
        > Thanks!
        > David
        >
        >
        >
        >
        >
        >
        >
        >
        > Yahoo! Groups Links
        >
        >
        >
        >
        >
        >
      • gayathri athreya
        Hi, I earlier had a similar issue with SOAP and have posted the solution in the following link, hope this helps.
        Message 3 of 3 , May 20 11:12 AM
        • 0 Attachment
          Hi,
               I earlier had a similar issue with SOAP and have posted the solution in the following link, hope this helps.

          http://groups.yahoo.com/group/perl_advanced_programmming/message/1342

          If the above link doesn't work please search in the message archives.

          Gayathri


          Eric Bridger <eric@...> wrote:
          I'd try sending 0 or a null string ''.

          On Thu, 2006-05-18 at 16:52, deandp357 wrote:
          > Hi, I'm having trouble sending a simple boolean across using
          > SOAP-Lite-0.67. My client call is:
          >
          > $result = $bs->submitSingleQuery(
          > 10,             # alignment limit
          > "",             # blast options
          > "genebookp",    # databaseName
          > 10,             # descripton limit
          > "false",        # filter opt
          > 0,              # priority
          > "perl",         # search name
          > "false",        # do html
          > "hsstromr",     # seq name
          > "protein",      # seq type
          > $QSEQ           # sequence
          > );
          >
          > But here's what the Axis server is receiving, as reported by the
          > SOAPMonitor utility:
          >
          > <?xml version="1.0" encoding="utf-8"?>
          > <soap:Envelope
          > soap:encodingStyle="http://schemas.xmlsoap.org/soap/encoding/"
          > xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance"
          > xmlns:soapenc="http://schemas.xmlsoap.org/soap/encoding/"
          > xmlns:xsd="http://www.w3.org/2001/XMLSchema"
          > xmlns:soap="http://schemas.xmlsoap.org/soap/envelope/">
          >   <soap:Body>
          >     <submitSingleQuery xmlns="urn:blastservice">
          >       <c-gensym3 xsi:type="xsd:int">10</c-gensym3>
          >       <c-gensym5 xsi:type="xsd:string"/>
          >       <c-gensym7 xsi:type="xsd:string">genebookp</c-gensym7>
          >       <c-gensym9 xsi:type="xsd:int">10</c-gensym9>
          >       <c-gensym11 xsi:type="xsd:boolean">true</c-gensym11>
          >       <c-gensym13 xsi:type="xsd:int">0</c-gensym13>
          >       <c-gensym15 xsi:type="xsd:string">perl</c-gensym15>
          >       <c-gensym17 xsi:type="xsd:boolean">true</c-gensym17>
          >       <c-gensym19 xsi:type="xsd:string">hsstromr</c-gensym19>
          >       <c-gensym21 xsi:type="xsd:string">protein</c-gensym21>
          >       <c-gensym23 xsi:type="xsd:string">
          >         &gt;hsstromr
          >         MKSLPILLLLCVAVCSAYPLDGAARGEDTSMNLVQKYLENYYDL
          >       </c-gensym23>
          >     </submitSingleQuery>
          >   </soap:Body>
          > </soap:Envelope>
          >
          > Thus 'false' is always sent as 'true', and 'true' results in 'true'
          > being sent. Is there something simple I'm missing?
          >
          > Thanks!
          > David
          >
          >
          >
          >
          >
          >
          >

          > Yahoo! Groups Links
          >
          >
          >

          >
          >





          ******"We shape the pot but it's the emptiness which holds whatever we want".******


          Do you have a question on a topic you cant find an Answer to. Try Yahoo! Answers India
          Get the all new Yahoo! Messenger Beta Now

        Your message has been successfully submitted and would be delivered to recipients shortly.