Loading ...
Sorry, an error occurred while loading the content.

5412Re: [soaplite] Sending a boolean?

Expand Messages
  • gayathri athreya
    May 20, 2006
      Hi,
           I earlier had a similar issue with SOAP and have posted the solution in the following link, hope this helps.

      http://groups.yahoo.com/group/perl_advanced_programmming/message/1342

      If the above link doesn't work please search in the message archives.

      Gayathri


      Eric Bridger <eric@...> wrote:
      I'd try sending 0 or a null string ''.

      On Thu, 2006-05-18 at 16:52, deandp357 wrote:
      > Hi, I'm having trouble sending a simple boolean across using
      > SOAP-Lite-0.67. My client call is:
      >
      > $result = $bs->submitSingleQuery(
      > 10,             # alignment limit
      > "",             # blast options
      > "genebookp",    # databaseName
      > 10,             # descripton limit
      > "false",        # filter opt
      > 0,              # priority
      > "perl",         # search name
      > "false",        # do html
      > "hsstromr",     # seq name
      > "protein",      # seq type
      > $QSEQ           # sequence
      > );
      >
      > But here's what the Axis server is receiving, as reported by the
      > SOAPMonitor utility:
      >
      > <?xml version="1.0" encoding="utf-8"?>
      > <soap:Envelope
      > soap:encodingStyle="http://schemas.xmlsoap.org/soap/encoding/"
      > xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance"
      > xmlns:soapenc="http://schemas.xmlsoap.org/soap/encoding/"
      > xmlns:xsd="http://www.w3.org/2001/XMLSchema"
      > xmlns:soap="http://schemas.xmlsoap.org/soap/envelope/">
      >   <soap:Body>
      >     <submitSingleQuery xmlns="urn:blastservice">
      >       <c-gensym3 xsi:type="xsd:int">10</c-gensym3>
      >       <c-gensym5 xsi:type="xsd:string"/>
      >       <c-gensym7 xsi:type="xsd:string">genebookp</c-gensym7>
      >       <c-gensym9 xsi:type="xsd:int">10</c-gensym9>
      >       <c-gensym11 xsi:type="xsd:boolean">true</c-gensym11>
      >       <c-gensym13 xsi:type="xsd:int">0</c-gensym13>
      >       <c-gensym15 xsi:type="xsd:string">perl</c-gensym15>
      >       <c-gensym17 xsi:type="xsd:boolean">true</c-gensym17>
      >       <c-gensym19 xsi:type="xsd:string">hsstromr</c-gensym19>
      >       <c-gensym21 xsi:type="xsd:string">protein</c-gensym21>
      >       <c-gensym23 xsi:type="xsd:string">
      >         &gt;hsstromr
      >         MKSLPILLLLCVAVCSAYPLDGAARGEDTSMNLVQKYLENYYDL
      >       </c-gensym23>
      >     </submitSingleQuery>
      >   </soap:Body>
      > </soap:Envelope>
      >
      > Thus 'false' is always sent as 'true', and 'true' results in 'true'
      > being sent. Is there something simple I'm missing?
      >
      > Thanks!
      > David
      >
      >
      >
      >
      >
      >
      >

      > Yahoo! Groups Links
      >
      >
      >

      >
      >





      ******"We shape the pot but it's the emptiness which holds whatever we want".******


      Do you have a question on a topic you cant find an Answer to. Try Yahoo! Answers India
      Get the all new Yahoo! Messenger Beta Now

    • Show all 3 messages in this topic