Loading ...
Sorry, an error occurred while loading the content.

File - === message truncated ===

Expand Messages
  • MirrorBeam2@yahoogroups.com
    Stop! Read no further! qplastix Pause: Qwertzuiopasdfghjklyxcvbnm Qertzuiopasdfghjklyxcvbnmw Qrtzuiopasdfghjklyxcvbnmwe Qtzuiopasdfghjklyxcvbnmwert If letters
    Message 1 of 303 , Jan 2, 2006
    View Source
    • 0 Attachment
      Stop!
      Read no further!

      qplastix


      Pause:

      Qwertzuiopasdfghjklyxcvbnm

      Qertzuiopasdfghjklyxcvbnmw

      Qrtzuiopasdfghjklyxcvbnmwe

      Qtzuiopasdfghjklyxcvbnmwert

      If letters were numbers and if pi was an endless
      accumulation of letters from a to z with a space in
      between, then you would eventually discover a sequence
      of letters which looked to your eye as the exact
      phrase below.


      I am the number of Pi. The number system I am using
      includes the letters a to z including the space zero,
      comma and period.

      I am the number of Pi. You are looking at an infinite
      arrangement of letters which are symbols for numbers
      which are symbols to describe how to calculate the
      circumference of a circle.

      I am this circle, and I am calculating myself.

      I am the number of Pi.






      Afhhglkah�lgkah�lkghsdjghksljhgkjdsghslkjfdghwurhtwoeutzoiwrtzoidhfsljvnlkm,okmijnuhbzgvtfcrdxesywayqyesxrdcftvzgbuhnijmokmoirutqpurztoiughakjlflhglkfjvbm,ynv,mfghyqaqaxwsxdecrgbzhnukmoplbfvufhuedhnsiokmxoswkxcmirufvbtugznijcmodkmokcmdiojvnrgufhnvhtbvztghvurfjncdejmcdokxwopsl,xpwl,dcoekfmvirjgnigjbrmgkomfoke,efdoklc,eofkvmgiubngzbuthznbirjfmcoed,cpld,coekrmvitunuhbnhujfnviewdkmxows,xpql,ypl,pla,ql,yowkmxwimdcijdncufrhnvuhrgbvuhtgbnuthgnviejcmowkdmxpsl,xpql,sypls,xokmricjnritjvnritjbnitbnfjinvijfmnivjnrhunuzhgbzhbedtxgfvrdcesyxewdscxwfcvdcgevtzgrfvbr7zhgbvuthgnbuitjhznizkmjuouk,jmolj,noz,bplhnmozkhmnzohknmijnvuhbudhcbiwdcjknrivfbutbhiedcnnejkcmocmfgnjklsjfhgueidmejvbrijnvoefnbjrhwkjhfwkjghwrkljwghrouitzofhskdjghkvbxcm,nvbmndfbgjkhgkejhtieruthkgjefhgkjsfhgkjshfgkherotuizeriutwzeurtztdfshgfdjhdgbcmcxnbvmxnbvmxcnvbmxcnvbmxcnvbksjfhkdjfghdkfjghkerutzieurtzieurtzieurtzidfughkdfjghkdfjghdkfjghxcvmnxbcvmnxcvbmxcnvbkjsfghkjdfhgkjhdfgkjhdfgoiuertoiuertoiuertoiuertoiuqweiuzqiweuziewurtzuwezrtuz
      wteruztweruztsdfjzgsdfjhgsdfjhgcvmnbcyvm,nbycmvnbxcvmnbasdfkjhasdkjhasdkjhasdkjherizewriuzwrtiuzertoiuertpoietpoiertpoiertpofisdgjklfghkdjghkdjfghkdjghkdjfghkdjfghkdjfgh


      STOP! Look no further!

      Pause.

      Focus your mind attention and the attention of your
      eyes at the words below.

      Stop!

      Look no further!

      Ksdfkjsdhfkjwheriouwezriuwrztieurztieurhtkejhgkjdfhvkdjghkdjfhgkdjfghkdjfghdkjfhnk,cvmbn,xmnb,xmcvnb,xcbvmjxcnvbjyxhcfhjagsdfhagsdfahsgdfhqgwefqzwterqzwterqzwterqzwtrasdhgasfdhagsdfhasgdfahsdgfyxcnbyxvcnbyxvcnybxcvnbvsdfkjhfgkjhdfkgjhdfgkjhtezoiurtzoiurtzoiurtzoiufghlkjfghlkjfhlkfhpoirupoitzupoitzuptoigfhlkjfhlkfjhlkfjhlkjcvb,mncvbm,ncbvmnbcvnbcvmgbdfjkghsdfkgfgjhgjrhtgiurtzierutzieurtzieurtzieurtzieurtziuerztieurtziuerztieurztieurztieurtzieurtzieurztiuerztiuerztiuezrtiuerztiuerztiuezrtiuzertiuzertiuzertiuzertiuezrtiuzertiuezrtiuezrtiuezrtiuezrtiuezrtiuzertiuzertiuzertiuezrtiuezrtiuerztiuertzieurtzieurtzieurtziuertzieurztiuerztiuezrtiuzeriutzeirutzierutzieurtzieurtzieurtzeirutzerituzeirutzeirutzeirutzieurtzierutzieurtzieurztieurztiuerztiuerztiuerztiuezrtiuezrtiuezrtiuzertuizfgkjdhfgkjhdfgkjhdfgkjhdfgkjhdfgkjhdfkgjhdfkgjhdfgkjdhfgkjdfhgkjdfhgkjdfghkjdfghkdjfghkdjfghkdjfghkjdfhgpoitzpoirtzpoirtzpoirtzpoirtzpoirtzopirpoziprotziportziportziprotzipoeritpoeritpeoriteprotiweporipoweirpowier
      powierpoiqwepoiqwepoiqwepoiqweoiqwueoiquweoiquweoiquweoiquweiuwezriuzweriuzweriuzqweuztqweuztqweuztqwuez
      t
      qwztrqwzetrqzwterzqtwerahsgdfjasdgfjasgdjhasdgsjghkjdfghkjdfghkjdgflkxjblkxjcblkjvblkjcvblkjcvblkjcvbjcvblkjcvblkjcvbkljcvblkjcvbmnbcxmvnbyxcmnbyxcmnbyxcmbnyxcmnbadfkjhsdfkljshdfkjhsdfkjhsdfkjhsdfkjhsdfkjhsdfkjhsdfkjhweiuzweriuzweriuzweriuzweriuzweiruzweiruzweriuzrtoiudhgoiughfjijnijonijnijnijnijnijnijnijnijnijnijnijnijnhubuhbuhbuhbuhbuhbuhbzgvzgvzgvzgvzgvzgvzgvtfctfctfctfctfcrdxrdxrdxrdxrdxesyesyesyesyesyesyesyesyesyesyqayqyqayqayqayqayqayqayqokaymqoakymqoymkqokaymqoymkoqkymoqakymqoykmwixjnwisjxnwisjxnwijxnwijxniwjxnwijxsnwijxneucdhbeudhcbeudhcbeudbhcuedhcbuecdhbeucdhbeudhcbzgwsxvzgwsvxzwgsxvzwgsxvzwgsvxzwgsvxzgwsvxzwgsxvqtyctqfacytqfyctqfyctqfyctacytfqcaytqfcaywszxgvwszgxvwzsgxvwzsgvxzwgvsxzwgsvxwzgsxvzwgsxvedchubeduhcbeudhcbeudhbcudbhcuebhdcuedhbcuecdbirjvnirjvfnirvfnirjvfnrijvnirvfnirjvfnrijvfnoktgmboktgmbotkgmboktgmboktmgboktgmbotkgmboktgmbokmzhnokmzhnokmzhnokmzhoknmzhoknmzhonkmzhokmnokmgijntgibjntigjnbitjgnboktgmbotkmotkgmbotkgmbpoipoeritpoertipoertipeotilskdjslkjsdlfkjsdlfkjsd
      lkfjsdlkfjsldkjflsdjflskjdflskdjflksdjflskdjflksdjflksjdflkjfgjdhfgjhfgklsdjfhglkjfdsghireuotzwoeirutzweortuizweortuizwertoiuzwertoiuwezrtoiwuerztowieurztwoieurtzwoieutzwioeurtzwoeiurtzwoiurtzwoeituzu
      iz iutzwrituozwuioz r twiztiutz
      iuzwieruzweiroutzeiorwutzkhja kfh kj
      kjahaksldjhaskljdfhaskldjhfaksljdfh
      akjfhasdkljfhasdlkjfhlkadjfhlaskjdfhkaldsfhadhskfhjasdfksdhklhkasdfhasdfkasdfhkhkdfashasdfkasdfhkkasdfkasdfhksdafasdfkjasdkfkasdfkjasdfksdafjksdfa
      kasdf kljh asdf
      kjahdfjhasdfasdkfjhasdkfjhasdlkfjahjkasdhfklasdjfh
      askldjfh asdkljfh skdafjlhjkh jkfhklasdjfh jkasf
      haksjdf haskljdfhlkasjdf hskadjf hskjdf hkasljdf
      hskajdfhkjasdfh sakldjf hkasjdf hkasljdfh ksjlf
      hklasjdfh kasldjfh lkjadfh ksdjalfh ajksd hfkajsdfh
      lkajsdfh oqwepruoiwu qeropiuerpoiqwuer poiqur qoiru
      qopieru qopiweru qopir ukom ookm kom jin ijn hu buhb
      gzv gzv ftc tfc rdx rdx qay qaywsx wsxed cedc rfv tgb
      zhbhn u mjik ol p




      Mir_ology is the art teaching yourself.


      I am the number of Pi.

      The letters and words you are reading are part of an
      infinite chain of letters, break.

      Iuertzieurztierutzeirutzeirutzeirutzierutz

      Sometimes over very long periods the same symbols are
      repeating themselves.

      For example as in
      000000000000000000000000000003.1..........................

      If this event occurs, you can start back at the top
      and jump from one paragraph to another because
      repetitions are normal.

      To explain you this number from the beginning
      oiuotiuerotiuerotiuerotiuerotiueorgijdflgkjdlfkgjldkfjgoeiurtzoeijhldknbkdvnbhldkgholeirjghopeiuzeoiuzeoiuzroiuzroiuzroiuhdoglhjdlkjhdlkfjglsdkjfoieruwoetzwiouztwiudhfskdjhngldfnhlkgjhlrituzorituzoertikhjlekfjhoefuigoeiruzoitjrhlkjfhlkdjflhdfiguoieurozieuzporiutpeioupoiuzopztiouwqzirtquetzruqwzetruwzetruwzetruweztruwezrtwuehgrjkwdhfksjdhfirgoeirutoiwueroitjlkwjlzkjflkjsdoiuofihjlgkhjl�gkhjlfgkjhsgh


      Start making sense, arranging letters and symbols in a
      certain order which are making sense is a coincidence,
      is a
      coincidnecevevebenemenennncncnencncencnecnencnencnencnencencnencnencnencencnencnenennnndnnendcnedncnedcnedncnedcnednncnedncnedncnedncdncnndncnedcnendcbdnbcnedbcehdgjehdgjhdgchedgcuztudztuzdtgvuzegvjkehfbvkjfhnljkwhjlkjlihjtiohjltkhjlrkjghoirtjoidhuiugduqwzfeuqwzgkqsjhbkjnv,mcn,vmxn,hdfnkjgndk
      fnvkdjfhgehrgioeurhglojglsdjhkdfgiuseziuwehfkwjehkjwhetiuwrztiefhgksjdnbfkjsdhfkwueztiuwrthiwejrhgkdjhfkldjfhnijnuhjrvbuzrhtvbzgrfcbedhuxisjwincrzbvfurbzvehfbvehrbgjehrhbnv
      mmamamamamamamammkkkkkkkkiingngnt senesessessssss

      Am iii mmmaakkingn sensneennsnsnsn

      Am I making sense, sense, sense, sense, sense,

      This is a repetition, this is no repetition, no
      repetition, no repetition,
      jhskkuuezukjkvmnkjhkjhfgjhgjzruzwerwkjhkjhkgjhrueirutzeijhkjv
      kh kjfh hk k kh kfh kn,mn n v ouoiwe lj wlwuroi
      lm okm ok ijn ijn uh bu hb zgv zgv tfc tfc rcrcrdxedxs
      y ay wex edxc rc rfc tv zg vzg bzuhbu h uijn ijni m
      ikmok mo kmionnu hb z gv g v v tfv ft ctfcr crd cx
      drx rdcft fcrf crdfc tfz gb uhbijbnivb ugv z gvc zcfc
      tfctcd xr dx rdx rdx rd xctfczgv g v zgv zgvhbhb
      njhbnuj nu b hb zgv tv tfc r cr dcx rfc tgv zb zhb
      hub uh uhbuhn ujn jn ijni m okm om okm ikn ij nij niu
      bnuh buzh b zg vtz gvtf cvtf c r dc erdx esx wsy
      wesxe dxr ct zvz gvb zubu hbu h buh b uhbu hb uhbn ef
      grbrgbrgbrg rgb tgb t n t b tgnhnzmjmumim m l mi jm
      j n h nz hn h btg bt gbt gb gtb tgb vfr f vfvdcdesxx
      qwsx s s cg z cd v h j k e t ui o n v xd r f
      z u n g t u n i kl m o l p o k jn u h z g b t f re d
      c f r t fv g z h b j i n m k o l p o k m n j i u h b g
      z t f v c d r es s x w wd d v f r g b h zt g h
      n b g h j u zu z h j mn m k i o l l p o k j u z
      h g t r f f d e er r v b g t z h n j i i k k m m
      n n j j h h g z t t f rdfguhg uh gu g uhguhg uhgu
      gug ugh gh g h g hgg gg m j j h h j
      j uu j h rrtt g g z z h h gg
      wed d f e e r f f t z z h h u ui i j
      uu h gt rt n j gh gh g q w we r t g
      h h j i i u z z tgb x o km fh ekjfgbkgvnsmf
      gfbd fbdfbn.............


      arranging letters in a way that you seem to understand
      them is a lotterygame.........


      ......hgjsdhfjsdhgfshdgfztruetzruewzgjdhcbsjbjsdhgfitoutoeiujejflkdjfghdugzeirutherjgkfnkdfjhixucziuhbfb......

      do you understand the meaning of this?


      It is called a question mark.
      Lsfkljksdjfijoijkjflkjdlkjghkjhgkjdhfgkdfgdgdfgdfgjdfhkgjdhfkgjdhfkgjdhfkgjhdgkheituzeituhwldkfjsldkfjpsoirpwjlkgjlsj
      is called a question mark.

      Numbers 0 to 9 correspond to letters a to z, space,
      comma, period, question and !mark.

      Alphalkjlkjflsdjflksdjlkjkjglglkjlkjlhkfjglhkfgjhlfkgjhlfkgjhlfkjhlfkgjhlkfgjhlkfjghlkfjhorituzorituzoijgldkjglskhskdgfjashdfurtuwetzrwiuzroutpepei�peor�tpoer�g�bpmbonbuiwbnuwhbuihuifwbucgwzgciuerggh


      Do you understand the nature of this
      letterererererreerererereriu.

      This message is an extent of a sequence in Pi.


      There are many more sequence in Pi, since this number
      is infinite.

      Also this letter is infinite.

      If it made sense to you, then it was a coincidence,
      because the rest of this letter goes, seog ekil siht,
      goes like this, this this this, thid, thid, thid,
      thif, thif ,thif, thif, thig, thig, tigh,
      tighhghghghghghgh,it, hgit, hgit, fiht, fiht, diht,
      siht, aiht, liht, kiht, jiht, giht, fiht, diht, siht,
      aiht, piht, oiht, ihit,
      ihihihnhjhizouojkjluozitughgzfgrtrgd,dhdgf, nghuc,
      fngjv, cnfjh, ngjh , dndhgitkihm, cndmf,f vm

      Is this in email account,,,fjfjgjgjgjgjgjg2yahoo.com

      Where is this message sending messges to....

      Heeeleleleeleoooooolllloo.......fgfgfhhggb.b.b.b.,,jjezzeheh

      Is this messsagaggeggjjfjfan email account,, ,,,


      Where is this message sending messages to,. ..


      We are sorry, mailer, account,

      is not an email addresss, ,, anymore.
      .,,mnijhsidfhijdhfkdkjsdjhdfdfsdfsdffff2yahoo.com is
      this message an email account. .....

      jump to sequence 509.

      Lucky shot,

      repetition sequence ignition, for next 20 centuries
      loggin avooutn "@
      message sent into empty starage container.

      Data useless, storage container empty, location
      delete. Store in account number zero.

      Zero_mailer_account.

      At Pi.

      3.14 enter.












      So if you are looking at the next link, imagine you
      created this web page yourself.

      In other words, imagine the empty message I've sent
      you about "imagination" contained the following web
      page.

      Look at this web page as the imagination of someone.







      themirrormachine@yahoogroups.com
      Zombiecatcher@...
      Mirrorgrave@...
      Mirrorland@yahoogroups.com
      Mirrorjourney@...

      Main junction, conjunction.


      Mirror journey.

      Heaven is the future, hell as well.
      Random by chance

      Please note: I am writing messages to myself and no
      one else, Deadrobot.
      Make moderators ready, make members ready.

      Main penalties:
      Robotics, Beam, Time Travel, Art Life. Art Int.


      Time Travel. Beam Art Int. Art. Life.

      Hello I've subscribed you to my address book.

      If you wish to be removed, please send email to
      deadrobot22@... Thanq. Robot.

      Whatever may happen to you inside a mirror, do not
      count on the people outside, for they may shout as
      loud as they can, if you are trapped inside a mirror
      you can not hear them.
      Remember the past, forget the future.
      For your eyes only.


      Deadrobots main terminal.



      What happens if the clock rotates past 12? Does the
      world end, does it begin, does it change at all?

      Check Randomdicovery add to list

      Chapter 11. Birth of the Machine

      Grab a cup of hot water, make yourself comfortable,
      take a deep breath and push the link below.

      Artificial Life
      Cognitive Science
      Unconscious Cognition
      Neuro Linguistic Programming
      Cognitive Psychology
      Behaviour Analysis.
      Education
      Information Technology
      Math Education
      Pi

      1 Group per Robot.

      If it's not me, then who is the person inside my
      mirror.

      Mother Board.

      And if a dead robot could write you a letter, what
      would you expect to be reading:




      AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
      BBBBBBBBBBBB
      CCCCCCC
      DDDD
      EE
      F
      FFF




      --- MAILER-DAEMON@... wrote:

      > Hi. This is the qmail-send program at yahoo.com.
      > I'm afraid I wasn't able to deliver your message to
      > the following addresses.
      > This is a permanent error; I've given up. Sorry it
      > didn't work out.
      >
      > <mailerdaemon@...>:
      > Sorry, I couldn't find a mail exchanger or IP
      > address. (#5.4.4)
      >
      > --- Below this line is a copy of the message.
      >
      > Return-Path: <zero_mailer_account@...>
      > Received: (qmail 3831 invoked by uid 60001); 22 Aug
      > 2005 21:47:57 -0000
      > DomainKey-Signature: a=rsa-sha1; q=dns; c=nofws;
      > s=s1024; d=yahoo.com;
      >
      >
      h=Message-ID:Received:Date:From:To:MIME-Version:Content-Type:Content-Transfer-Encoding;
      >
      >
      b=JuvrxJuyTPzgwnSimC0uES0TAz/1G1t4OhictTu5NnMkEPo+RlgFG067CdfN0XtSnuP8KGwnZStqrD8j2FStiaPWFs9fdG2e380PR25bCON31LnEPT6eH1rFTHlY0WPzyu97K0CZULHs1UAex+OhG2PZWUe38UXAQMhvVb9UzVQ=
      > ;
      > Message-ID:
      >
      <20050822214757.3829.qmail@...>
      > Received: from [82.195.239.20] by
      > web35213.mail.mud.yahoo.com via HTTP; Mon, 22 Aug
      > 2005 14:47:57 PDT
      > Date: Mon, 22 Aug 2005 14:47:57 -0700 (PDT)
      > From: Mailer Accountent
      > <zero_mailer_account@...>
      > To: mailerdaemon@...
      > MIME-Version: 1.0
      > Content-Type: text/plain; charset=iso-8859-1
      > Content-Transfer-Encoding: 8bit
      >
      > Stop!
      > Read no further!
      >
      > qplastix
      >
      >
      > Pause:
      >
      > Qwertzuiopasdfghjklyxcvbnm
      >
      > Qertzuiopasdfghjklyxcvbnmw
      >
      > Qrtzuiopasdfghjklyxcvbnmwe
      >
      > Qtzuiopasdfghjklyxcvbnmwert
      >
      > If letters were numbers and if pi was an endless
      > accumulation of letters from a to z with a space in
      > between, then you would eventually discover a
      > sequence
      > of letters which looked to your eye as the exact
      > phrase below.
      >
      >
      > I am the number of Pi. The number system I am using
      > includes the letters a to z including the space
      > zero,
      > comma and period.
      >
      > I am the number of Pi. You are looking at an
      > infinite
      > arrangement of letters which are symbols for numbers
      > which are symbols to describe how to calculate the
      > circumference of a circle.
      >
      > I am this circle, and I am calculating myself.
      >
      > I am the number of Pi.
      >
      >
      >
      >
      >
      >
      >
      Afhhglkah�lgkah�lkghsdjghksljhgkjdsghslkjfdghwurhtwoeutzoiwrtzoidhfsljvnlkm,okmijnuhbzgvtfcrdxesywayqyesxrdcftvzgbuhnijmokmoirutqpurztoiughakjlflhglkfjvbm,ynv,mfghyqaqaxwsxdecrgbzhnukmoplbfvufhuedhnsiokmxoswkxcmirufvbtugznijcmodkmokcmdiojvnrgufhnvhtbvztghvurfjncdejmcdokxwopsl,xpwl,dcoekfmvirjgnigjbrmgkomfoke,efdoklc,eofkvmgiubngzbuthznbirjfmcoed,cpld,coekrmvitunuhbnhujfnviewdkmxows,xpql,ypl,pla,ql,yowkmxwimdcijdncufrhnvuhrgbvuhtgbnuthgnviejcmowkdmxpsl,xpql,sypls,xokmricjnritjvnritjbnitbnfjinvijfmnivjnrhunuzhgbzhbedtxgfvrdcesyxewdscxwfcvdcgevtzgrfvbr7zhgbvuthgnbuitjhznizkmjuouk,jmolj,noz,bplhnmozkhmnzohknmijnvuhbudhcbiwdcjknrivfbutbhiedcnnejkcmocmfgnjklsjfhgueidmejvbrijnvoefnbjrhwkjhfwkjghwrkljwghrouitzofhskdjghkvbxcm,nvbmndfbgjkhgkejhtieruthkgjefhgkjsfhgkjshfgkherotuizeriutwzeurtztdfshgfdjhdgbcmcxnbvmxnbvmxcnvbmxcnvbmxcnvbksjfhkdjfghdkfjghkerutzieurtzieurtzieurtzidfughkdfjghkdfjghdkfjghxcvmnxbcvmnxcvbmxcnvbkjsfghkjdfhgkjhdfgkjhdfgoiuertoiuertoiuertoiuertoiuqweiuzqiweuziewurtzuwezrtuz
      >
      wteruztweruztsdfjzgsdfjhgsdfjhgcvmnbcyvm,nbycmvnbxcvmnbasdfkjhasdkjhasdkjhasdkjherizewriuzwrtiuzertoiuertpoietpoiertpoiertpofisdgjklfghkdjghkdjfghkdjghkdjfghkdjfghkdjfgh
      >
      >
      > STOP! Look no further!
      >
      > Pause.
      >
      > Focus your mind attention and the attention of your
      > eyes at the words below.
      >
      > Stop!
      >
      > Look no further!
      >
      >
      Ksdfkjsdhfkjwheriouwezriuwrztieurztieurhtkejhgkjdfhvkdjghkdjfhgkdjfghkdjfghdkjfhnk,cvmbn,xmnb,xmcvnb,xcbvmjxcnvbjyxhcfhjagsdfhagsdfahsgdfhqgwefqzwterqzwterqzwterqzwtrasdhgasfdhagsdfhasgdfahsdgfyxcnbyxvcnbyxvcnybxcvnbvsdfkjhfgkjhdfkgjhdfgkjhtezoiurtzoiurtzoiurtzoiufghlkjfghlkjfhlkfhpoirupoitzupoitzuptoigfhlkjfhlkfjhlkfjhlkjcvb,mncvbm,ncbvmnbcvnbcvmgbdfjkghsdfkgfgjhgjrhtgiurtzierutzieurtzieurtzieurtzieurtziuerztieurtziuerztieurztieurztieurtzieurtzieurztiuerztiuerztiuezrtiuerztiuerztiuezrtiuzertiuzertiuzertiuzertiuezrtiuzertiuezrtiuezrtiuezrtiuezrtiuezrtiuzertiuzertiuzertiuezrtiuezrtiuerztiuertzieurtzieurtzieurtziuertzieurztiuerztiuezrtiuzeriutzeirutzierutzieurtzieurtzieurtzeirutzerituzeirutzeirutzeirutzieurtzierutzieurtzieurztieurztiuerztiuerztiuerztiuezrtiuezrtiuezrtiuzertuizfgkjdhfgkjhdfgkjhdfgkjhdfgkjhdfgkjhdfkgjhdfkgjhdfgkjdhfgkjdfhgkjdfhgkjdfghkjdfghkdjfghkdjfghkdjfghkjdfhgpoitzpoirtzpoirtzpoirtzpoirtzpoirtzopirpoziprotziportziportziprotzipoeritpoeritpeoriteprotiweporipoweirpowier
      >
      powierpoiqwepoiqwepoiqwepoiqweoiqwueoiquweoiquweoiquweoiquweiuwezriuzweriuzweriuzqweuztqweuztqweuztqwuez
      > t
      >
      qwztrqwzetrqzwterzqtwerahsgdfjasdgfjasgdjhasdgsjghkjdfghkjdfghkjdgflkxjblkxjcblkjvblkjcvblkjcvblkjcvbjcvblkjcvblkjcvbkljcvblkjcvbmnbcxmvnbyxcmnbyxcmnbyxcmbnyxcmnbadfkjhsdfkljshdfkjhsdfkjhsdfkjhsdfkjhsdfkjhsdfkjhsdfkjhweiuzweriuzweriuzweriuzweriuzweiruzweiruzweriuzrtoiudhgoiughfjijnijonijnijnijnijnijnijnijnijnijnijnijnijnhubuhbuhbuhbuhbuhbuhbzgvzgvzgvzgvzgvzgvzgvtfctfctfctfctfcrdxrdxrdxrdxrdxesyesyesyesyesyesyesyesyesyesyqayqyqayqayqayqayqayqayqokaymqoakymqoymkqokaymqoymkoqkymoqakymqoykmwixjnwisjxnwisjxnwijxnwijxniwjxnwijxsnwijxneucdhbeudhcbeudhcbeudbhcuedhcbuecdhbeucdhbeudhcbzgwsxvzgwsvxzwgsxvzwgsxvzwgsvxzwgsvxzgwsvxzwgsxvqtyctqfacytqfyctqfyctqfyctacytfqcaytqfcaywszxgvwszgxvwzsgxvwzsgvxzwgvsxzwgsvxwzgsxvzwgsxvedchubeduhcbeudhcbeudhbcudbhcuebhdcuedhbcuecdbirjvnirjvfnirvfnirjvfnrijvnirvfnirjvfnrijvfnoktgmboktgmbotkgmboktgmboktmgboktgmbotkgmboktgmbokmzhnokmzhnokmzhnokmzhoknmzhoknmzhonkmzhokmnokmgijntgibjntigjnbitjgnboktgmbotkmotkgmbotkgmbpoipoeritpoertipoertipeotilskdjslkjsdlfkjsdlfkjsd
      >
      lkfjsdlkfjsldkjflsdjflskjdflskdjflksdjflskdjflksdjflksjdflkjfgjdhfgjhfgklsdjfhglkjfdsghireuotzwoeirutzweortuizweortuizwertoiuzwertoiuwezrtoiwuerztowieurztwoieurtzwoieutzwioeurtzwoeiurtzwoiurtzwoeituzu
      > iz iutzwrituozwuioz r twiztiutz
      > iuzwieruzweiroutzeiorwutzkhja kfh kj
      > kjahaksldjhaskljdfhaskldjhfaksljdfh
      >
      akjfhasdkljfhasdlkjfhlkadjfhlaskjdfhkaldsfhadhskfhjasdfksdhklhkasdfhasdfkasdfhkhkdfashasdfkasdfhkkasdfkasdfhksdafasdfkjasdkfkasdfkjasdfksdafjksdfa
      > kasdf kljh asdf
      > kjahdfjhasdfasdkfjhasdkfjhasdlkfjahjkasdhfklasdjfh
      > askldjfh asdkljfh skdafjlhjkh jkfhklasdjfh jkasf
      > haksjdf haskljdfhlkasjdf hskadjf hskjdf hkasljdf
      > hskajdfhkjasdfh sakldjf hkasjdf hkasljdfh ksjlf
      > hklasjdfh kasldjfh lkjadfh ksdjalfh ajksd hfkajsdfh
      > lkajsdfh oqwepruoiwu qeropiuerpoiqwuer poiqur qoiru
      > qopieru qopiweru qopir ukom ookm kom jin ijn hu buhb
      > gzv gzv ftc tfc rdx rdx qay qaywsx wsxed cedc rfv
      > tgb
      > zhbhn u mjik ol p
      >
      >
      >
      >
      > Mir_ology is the art teaching yourself.
      >
      >
      > I am the number of Pi.
      >
      > The letters and words you are reading are part of an
      > infinite chain of letters, break.
      >
      > Iuertzieurztierutzeirutzeirutzeirutzierutz
      >
      > Sometimes over very long periods the same symbols
      > are
      > repeating themselves.
      >
      > For example as in
      >
      000000000000000000000000000003.1..........................
      >
      > If this event occurs, you can start back at the top
      > and jump from one paragraph to another because
      > repetitions are normal.
      >
      > To explain you this number from the beginning
      >
      oiuotiuerotiuerotiuerotiuerotiueorgijdflgkjdlfkgjldkfjgoeiurtzoeijhldknbkdvnbhldkgholeirjghopeiuzeoiuzeoiuzroiuzroiuzroiuhdoglhjdlkjhdlkfjglsdkjfoieruwoetzwiouztwiudhfskdjhngldfnhlkgjhlrituzorituzoertikhjlekfjhoefuigoeiruzoitjrhlkjfhlkdjflhdfiguoieurozieuzporiutpeioupoiuzopztiouwqzirtquetzruqwzetruwzetruwzetruweztruwezrtwuehgrjkwdhfksjdhfirgoeirutoiwueroitjlkwjlzkjflkjsdoiuofihjlgkhjl�gkhjlfgkjhsgh
      >
      >
      > Start making sense, arranging letters and symbols in
      > a
      > certain order which are making sense is a
      > coincidence,
      > is a
      >
      coincidnecevevebenemenennncncnencncencnecnencnencnencnencencnencnencnencencnencnenennnndnnendcnedncnedcnedncnedcnednncnedncnedncnedncdncnndncnedcnendcbdnbcnedbcehdgjehdgjhdgchedgcuztudztuzdtgvuzegvjkehfbvkjfhnljkwhjlkjlihjtiohjltkhjlrkjghoirtjoidhuiugduqwzfeuqwzgkqsjhbkjnv,mcn,vmxn,hdfnkjgndk
      >
      fnvkdjfhgehrgioeurhglojglsdjhkdfgiuseziuwehfkwjehkjwhetiuwrztiefhgksjdnbfkjsdhfkwueztiuwrthiwejrhgkdjhfkldjfhnijnuhjrvbuzrhtvbzgrfcbedhuxisjwincrzbvfurbzvehfbvehrbgjehrhbnv
      > mmamamamamamamammkkkkkkkkiingngnt senesessessssss
      >
      > Am iii mmmaakkingn sensneennsnsnsn
      >
      > Am I making sense, sense, sense, sense, sense,
      >
      > This is a repetition, this is no repetition, no
      > repetition, no repetition,
      >
      jhskkuuezukjkvmnkjhkjhfgjhgjzruzwerwkjhkjhkgjhrueirutzeijhkjv
      > kh kjfh hk k kh kfh kn,mn n v ouoiwe lj wlwuroi
      >
      > lm okm ok ijn ijn uh bu hb zgv zgv tfc tfc
      > rcrcrdxedxs
      > y ay wex edxc rc rfc tv zg vzg bzuhbu h uijn ijni m
      > ikmok mo kmionnu hb z gv g v v tfv ft ctfcr crd cx
      > drx rdcft fcrf crdfc tfz gb uhbijbnivb ugv z gvc
      > zcfc
      > tfctcd xr dx rdx rdx rd xctfczgv g v zgv zgvhbhb
      > njhbnuj nu b hb zgv tv tfc r cr dcx rfc tgv zb zhb
      > hub uh uhbuhn ujn jn ijni m okm om okm ikn ij nij
      > niu
      > bnuh buzh b zg vtz gvtf cvtf c r dc erdx esx wsy
      > wesxe dxr ct zvz gvb zubu hbu h buh b uhbu hb uhbn
      > ef
      > grbrgbrgbrg rgb tgb t n t b tgnhnzmjmumim m l mi
      > jm
      > j n h nz hn h btg bt gbt gb gtb tgb vfr f
      > vfvdcdesxx
      > qwsx s s cg z cd v h j k e t ui o n v xd r
      > f
      > z u n g t u n i kl m o l p o k jn u h z g b t f re
      > d
      > c f r t fv g z h b j i n m k o l p o k m n j i u h b
      > g
      > z t f v c d r es s x w wd d v f r g b h zt g
      > h
      > n b g h j u zu z h j mn m k i o l l p o k j u z
      >
      > h g t r f f d e er r v b g t z h n j i i k k m
      > m
      > n n j j h h g z t t f rdfguhg uh gu g uhguhg uhgu
      > gug ugh gh g h g hgg gg m j j h h
      > j
      > j uu j h rrtt g g z z h h gg
      >
      > wed d f e e r f f t z z h h u ui i
      > j
      > uu h gt rt n j gh gh g q w we r t
      > g
      > h h j i i u z z tgb x o km fh ekjfgbkgvnsmf
      > gfbd fbdfbn.............
      >
      === message truncated ===
    • Mirror2Beam@yahoogroups.com
      Stop! Read no further! qplastix Pause: Qwertzuiopasdfghjklyxcvbnm Qertzuiopasdfghjklyxcvbnmw Qrtzuiopasdfghjklyxcvbnmwe Qtzuiopasdfghjklyxcvbnmwert If letters
      Message 303 of 303 , Apr 13 12:24 AM
      View Source
      • 0 Attachment
        Stop!
        Read no further!

        qplastix


        Pause:

        Qwertzuiopasdfghjklyxcvbnm

        Qertzuiopasdfghjklyxcvbnmw

        Qrtzuiopasdfghjklyxcvbnmwe

        Qtzuiopasdfghjklyxcvbnmwert

        If letters were numbers and if pi was an endless
        accumulation of letters from a to z with a space in
        between, then you would eventually discover a sequence
        of letters which looked to your eye as the exact
        phrase below.


        I am the number of Pi. The number system I am using
        includes the letters a to z including the space zero,
        comma and period.

        I am the number of Pi. You are looking at an infinite
        arrangement of letters which are symbols for numbers
        which are symbols to describe how to calculate the
        circumference of a circle.

        I am this circle, and I am calculating myself.

        I am the number of Pi.






        Afhhglkah�lgkah�lkghsdjghksljhgkjdsghslkjfdghwurhtwoeutzoiwrtzoidhfsljvnlkm,okmijnuhbzgvtfcrdxesywayqyesxrdcftvzgbuhnijmokmoirutqpurztoiughakjlflhglkfjvbm,ynv,mfghyqaqaxwsxdecrgbzhnukmoplbfvufhuedhnsiokmxoswkxcmirufvbtugznijcmodkmokcmdiojvnrgufhnvhtbvztghvurfjncdejmcdokxwopsl,xpwl,dcoekfmvirjgnigjbrmgkomfoke,efdoklc,eofkvmgiubngzbuthznbirjfmcoed,cpld,coekrmvitunuhbnhujfnviewdkmxows,xpql,ypl,pla,ql,yowkmxwimdcijdncufrhnvuhrgbvuhtgbnuthgnviejcmowkdmxpsl,xpql,sypls,xokmricjnritjvnritjbnitbnfjinvijfmnivjnrhunuzhgbzhbedtxgfvrdcesyxewdscxwfcvdcgevtzgrfvbr7zhgbvuthgnbuitjhznizkmjuouk,jmolj,noz,bplhnmozkhmnzohknmijnvuhbudhcbiwdcjknrivfbutbhiedcnnejkcmocmfgnjklsjfhgueidmejvbrijnvoefnbjrhwkjhfwkjghwrkljwghrouitzofhskdjghkvbxcm,nvbmndfbgjkhgkejhtieruthkgjefhgkjsfhgkjshfgkherotuizeriutwzeurtztdfshgfdjhdgbcmcxnbvmxnbvmxcnvbmxcnvbmxcnvbksjfhkdjfghdkfjghkerutzieurtzieurtzieurtzidfughkdfjghkdfjghdkfjghxcvmnxbcvmnxcvbmxcnvbkjsfghkjdfhgkjhdfgkjhdfgoiuertoiuertoiuertoiuertoiuqweiuzqiweuziewurtzuwezrtuz
        wteruztweruztsdfjzgsdfjhgsdfjhgcvmnbcyvm,nbycmvnbxcvmnbasdfkjhasdkjhasdkjhasdkjherizewriuzwrtiuzertoiuertpoietpoiertpoiertpofisdgjklfghkdjghkdjfghkdjghkdjfghkdjfghkdjfgh


        STOP! Look no further!

        Pause.

        Focus your mind attention and the attention of your
        eyes at the words below.

        Stop!

        Look no further!

        Ksdfkjsdhfkjwheriouwezriuwrztieurztieurhtkejhgkjdfhvkdjghkdjfhgkdjfghkdjfghdkjfhnk,cvmbn,xmnb,xmcvnb,xcbvmjxcnvbjyxhcfhjagsdfhagsdfahsgdfhqgwefqzwterqzwterqzwterqzwtrasdhgasfdhagsdfhasgdfahsdgfyxcnbyxvcnbyxvcnybxcvnbvsdfkjhfgkjhdfkgjhdfgkjhtezoiurtzoiurtzoiurtzoiufghlkjfghlkjfhlkfhpoirupoitzupoitzuptoigfhlkjfhlkfjhlkfjhlkjcvb,mncvbm,ncbvmnbcvnbcvmgbdfjkghsdfkgfgjhgjrhtgiurtzierutzieurtzieurtzieurtzieurtziuerztieurtziuerztieurztieurztieurtzieurtzieurztiuerztiuerztiuezrtiuerztiuerztiuezrtiuzertiuzertiuzertiuzertiuezrtiuzertiuezrtiuezrtiuezrtiuezrtiuezrtiuzertiuzertiuzertiuezrtiuezrtiuerztiuertzieurtzieurtzieurtziuertzieurztiuerztiuezrtiuzeriutzeirutzierutzieurtzieurtzieurtzeirutzerituzeirutzeirutzeirutzieurtzierutzieurtzieurztieurztiuerztiuerztiuerztiuezrtiuezrtiuezrtiuzertuizfgkjdhfgkjhdfgkjhdfgkjhdfgkjhdfgkjhdfkgjhdfkgjhdfgkjdhfgkjdfhgkjdfhgkjdfghkjdfghkdjfghkdjfghkdjfghkjdfhgpoitzpoirtzpoirtzpoirtzpoirtzpoirtzopirpoziprotziportziportziprotzipoeritpoeritpeoriteprotiweporipoweirpowier
        powierpoiqwepoiqwepoiqwepoiqweoiqwueoiquweoiquweoiquweoiquweiuwezriuzweriuzweriuzqweuztqweuztqweuztqwuez
        t
        qwztrqwzetrqzwterzqtwerahsgdfjasdgfjasgdjhasdgsjghkjdfghkjdfghkjdgflkxjblkxjcblkjvblkjcvblkjcvblkjcvbjcvblkjcvblkjcvbkljcvblkjcvbmnbcxmvnbyxcmnbyxcmnbyxcmbnyxcmnbadfkjhsdfkljshdfkjhsdfkjhsdfkjhsdfkjhsdfkjhsdfkjhsdfkjhweiuzweriuzweriuzweriuzweriuzweiruzweiruzweriuzrtoiudhgoiughfjijnijonijnijnijnijnijnijnijnijnijnijnijnijnhubuhbuhbuhbuhbuhbuhbzgvzgvzgvzgvzgvzgvzgvtfctfctfctfctfcrdxrdxrdxrdxrdxesyesyesyesyesyesyesyesyesyesyqayqyqayqayqayqayqayqayqokaymqoakymqoymkqokaymqoymkoqkymoqakymqoykmwixjnwisjxnwisjxnwijxnwijxniwjxnwijxsnwijxneucdhbeudhcbeudhcbeudbhcuedhcbuecdhbeucdhbeudhcbzgwsxvzgwsvxzwgsxvzwgsxvzwgsvxzwgsvxzgwsvxzwgsxvqtyctqfacytqfyctqfyctqfyctacytfqcaytqfcaywszxgvwszgxvwzsgxvwzsgvxzwgvsxzwgsvxwzgsxvzwgsxvedchubeduhcbeudhcbeudhbcudbhcuebhdcuedhbcuecdbirjvnirjvfnirvfnirjvfnrijvnirvfnirjvfnrijvfnoktgmboktgmbotkgmboktgmboktmgboktgmbotkgmboktgmbokmzhnokmzhnokmzhnokmzhoknmzhoknmzhonkmzhokmnokmgijntgibjntigjnbitjgnboktgmbotkmotkgmbotkgmbpoipoeritpoertipoertipeotilskdjslkjsdlfkjsdlfkjsd
        lkfjsdlkfjsldkjflsdjflskjdflskdjflksdjflskdjflksdjflksjdflkjfgjdhfgjhfgklsdjfhglkjfdsghireuotzwoeirutzweortuizweortuizwertoiuzwertoiuwezrtoiwuerztowieurztwoieurtzwoieutzwioeurtzwoeiurtzwoiurtzwoeituzu
        iz iutzwrituozwuioz r twiztiutz
        iuzwieruzweiroutzeiorwutzkhja kfh kj
        kjahaksldjhaskljdfhaskldjhfaksljdfh
        akjfhasdkljfhasdlkjfhlkadjfhlaskjdfhkaldsfhadhskfhjasdfksdhklhkasdfhasdfkasdfhkhkdfashasdfkasdfhkkasdfkasdfhksdafasdfkjasdkfkasdfkjasdfksdafjksdfa
        kasdf kljh asdf
        kjahdfjhasdfasdkfjhasdkfjhasdlkfjahjkasdhfklasdjfh
        askldjfh asdkljfh skdafjlhjkh jkfhklasdjfh jkasf
        haksjdf haskljdfhlkasjdf hskadjf hskjdf hkasljdf
        hskajdfhkjasdfh sakldjf hkasjdf hkasljdfh ksjlf
        hklasjdfh kasldjfh lkjadfh ksdjalfh ajksd hfkajsdfh
        lkajsdfh oqwepruoiwu qeropiuerpoiqwuer poiqur qoiru
        qopieru qopiweru qopir ukom ookm kom jin ijn hu buhb
        gzv gzv ftc tfc rdx rdx qay qaywsx wsxed cedc rfv tgb
        zhbhn u mjik ol p




        Mir_ology is the art teaching yourself.


        I am the number of Pi.

        The letters and words you are reading are part of an
        infinite chain of letters, break.

        Iuertzieurztierutzeirutzeirutzeirutzierutz

        Sometimes over very long periods the same symbols are
        repeating themselves.

        For example as in
        000000000000000000000000000003.1..........................

        If this event occurs, you can start back at the top
        and jump from one paragraph to another because
        repetitions are normal.

        To explain you this number from the beginning
        oiuotiuerotiuerotiuerotiuerotiueorgijdflgkjdlfkgjldkfjgoeiurtzoeijhldknbkdvnbhldkgholeirjghopeiuzeoiuzeoiuzroiuzroiuzroiuhdoglhjdlkjhdlkfjglsdkjfoieruwoetzwiouztwiudhfskdjhngldfnhlkgjhlrituzorituzoertikhjlekfjhoefuigoeiruzoitjrhlkjfhlkdjflhdfiguoieurozieuzporiutpeioupoiuzopztiouwqzirtquetzruqwzetruwzetruwzetruweztruwezrtwuehgrjkwdhfksjdhfirgoeirutoiwueroitjlkwjlzkjflkjsdoiuofihjlgkhjl�gkhjlfgkjhsgh


        Start making sense, arranging letters and symbols in a
        certain order which are making sense is a coincidence,
        is a
        coincidnecevevebenemenennncncnencncencnecnencnencnencnencencnencnencnencencnencnenennnndnnendcnedncnedcnedncnedcnednncnedncnedncnedncdncnndncnedcnendcbdnbcnedbcehdgjehdgjhdgchedgcuztudztuzdtgvuzegvjkehfbvkjfhnljkwhjlkjlihjtiohjltkhjlrkjghoirtjoidhuiugduqwzfeuqwzgkqsjhbkjnv,mcn,vmxn,hdfnkjgndk
        fnvkdjfhgehrgioeurhglojglsdjhkdfgiuseziuwehfkwjehkjwhetiuwrztiefhgksjdnbfkjsdhfkwueztiuwrthiwejrhgkdjhfkldjfhnijnuhjrvbuzrhtvbzgrfcbedhuxisjwincrzbvfurbzvehfbvehrbgjehrhbnv
        mmamamamamamamammkkkkkkkkiingngnt senesessessssss

        Am iii mmmaakkingn sensneennsnsnsn

        Am I making sense, sense, sense, sense, sense,

        This is a repetition, this is no repetition, no
        repetition, no repetition,
        jhskkuuezukjkvmnkjhkjhfgjhgjzruzwerwkjhkjhkgjhrueirutzeijhkjv
        kh kjfh hk k kh kfh kn,mn n v ouoiwe lj wlwuroi
        lm okm ok ijn ijn uh bu hb zgv zgv tfc tfc rcrcrdxedxs
        y ay wex edxc rc rfc tv zg vzg bzuhbu h uijn ijni m
        ikmok mo kmionnu hb z gv g v v tfv ft ctfcr crd cx
        drx rdcft fcrf crdfc tfz gb uhbijbnivb ugv z gvc zcfc
        tfctcd xr dx rdx rdx rd xctfczgv g v zgv zgvhbhb
        njhbnuj nu b hb zgv tv tfc r cr dcx rfc tgv zb zhb
        hub uh uhbuhn ujn jn ijni m okm om okm ikn ij nij niu
        bnuh buzh b zg vtz gvtf cvtf c r dc erdx esx wsy
        wesxe dxr ct zvz gvb zubu hbu h buh b uhbu hb uhbn ef
        grbrgbrgbrg rgb tgb t n t b tgnhnzmjmumim m l mi jm
        j n h nz hn h btg bt gbt gb gtb tgb vfr f vfvdcdesxx
        qwsx s s cg z cd v h j k e t ui o n v xd r f
        z u n g t u n i kl m o l p o k jn u h z g b t f re d
        c f r t fv g z h b j i n m k o l p o k m n j i u h b g
        z t f v c d r es s x w wd d v f r g b h zt g h
        n b g h j u zu z h j mn m k i o l l p o k j u z
        h g t r f f d e er r v b g t z h n j i i k k m m
        n n j j h h g z t t f rdfguhg uh gu g uhguhg uhgu
        gug ugh gh g h g hgg gg m j j h h j
        j uu j h rrtt g g z z h h gg
        wed d f e e r f f t z z h h u ui i j
        uu h gt rt n j gh gh g q w we r t g
        h h j i i u z z tgb x o km fh ekjfgbkgvnsmf
        gfbd fbdfbn.............


        arranging letters in a way that you seem to understand
        them is a lotterygame.........


        ......hgjsdhfjsdhgfshdgfztruetzruewzgjdhcbsjbjsdhgfitoutoeiujejflkdjfghdugzeirutherjgkfnkdfjhixucziuhbfb......

        do you understand the meaning of this?


        It is called a question mark.
        Lsfkljksdjfijoijkjflkjdlkjghkjhgkjdhfgkdfgdgdfgdfgjdfhkgjdhfkgjdhfkgjdhfkgjhdgkheituzeituhwldkfjsldkfjpsoirpwjlkgjlsj
        is called a question mark.

        Numbers 0 to 9 correspond to letters a to z, space,
        comma, period, question and !mark.

        Alphalkjlkjflsdjflksdjlkjkjglglkjlkjlhkfjglhkfgjhlfkgjhlfkgjhlfkjhlfkgjhlkfgjhlkfjghlkfjhorituzorituzoijgldkjglskhskdgfjashdfurtuwetzrwiuzroutpepei�peor�tpoer�g�bpmbonbuiwbnuwhbuihuifwbucgwzgciuerggh


        Do you understand the nature of this
        letterererererreerererereriu.

        This message is an extent of a sequence in Pi.


        There are many more sequence in Pi, since this number
        is infinite.

        Also this letter is infinite.

        If it made sense to you, then it was a coincidence,
        because the rest of this letter goes, seog ekil siht,
        goes like this, this this this, thid, thid, thid,
        thif, thif ,thif, thif, thig, thig, tigh,
        tighhghghghghghgh,it, hgit, hgit, fiht, fiht, diht,
        siht, aiht, liht, kiht, jiht, giht, fiht, diht, siht,
        aiht, piht, oiht, ihit,
        ihihihnhjhizouojkjluozitughgzfgrtrgd,dhdgf, nghuc,
        fngjv, cnfjh, ngjh , dndhgitkihm, cndmf,f vm

        Is this in email account,,,fjfjgjgjgjgjgjg2yahoo.com

        Where is this message sending messges to....

        Heeeleleleeleoooooolllloo.......fgfgfhhggb.b.b.b.,,jjezzeheh

        Is this messsagaggeggjjfjfan email account,, ,,,


        Where is this message sending messages to,. ..


        We are sorry, mailer, account,

        is not an email addresss, ,, anymore.
        .,,mnijhsidfhijdhfkdkjsdjhdfdfsdfsdffff2yahoo.com is
        this message an email account. .....

        jump to sequence 509.

        Lucky shot,

        repetition sequence ignition, for next 20 centuries
        loggin avooutn "@
        message sent into empty starage container.

        Data useless, storage container empty, location
        delete. Store in account number zero.

        Zero_mailer_account.

        At Pi.

        3.14 enter.












        So if you are looking at the next link, imagine you
        created this web page yourself.

        In other words, imagine the empty message I've sent
        you about "imagination" contained the following web
        page.

        Look at this web page as the imagination of someone.







        themirrormachine@yahoogroups.com
        Zombiecatcher@...
        Mirrorgrave@...
        Mirrorland@yahoogroups.com
        Mirrorjourney@...

        Main junction, conjunction.


        Mirror journey.

        Heaven is the future, hell as well.
        Random by chance

        Please note: I am writing messages to myself and no
        one else, Deadrobot.
        Make moderators ready, make members ready.

        Main penalties:
        Robotics, Beam, Time Travel, Art Life. Art Int.


        Time Travel. Beam Art Int. Art. Life.

        Hello I've subscribed you to my address book.

        If you wish to be removed, please send email to
        deadrobot22@... Thanq. Robot.

        Whatever may happen to you inside a mirror, do not
        count on the people outside, for they may shout as
        loud as they can, if you are trapped inside a mirror
        you can not hear them.
        Remember the past, forget the future.
        For your eyes only.


        Deadrobots main terminal.



        What happens if the clock rotates past 12? Does the
        world end, does it begin, does it change at all?

        Check Randomdicovery add to list

        Chapter 11. Birth of the Machine

        Grab a cup of hot water, make yourself comfortable,
        take a deep breath and push the link below.

        Artificial Life
        Cognitive Science
        Unconscious Cognition
        Neuro Linguistic Programming
        Cognitive Psychology
        Behaviour Analysis.
        Education
        Information Technology
        Math Education
        Pi

        1 Group per Robot.

        If it's not me, then who is the person inside my
        mirror.

        Mother Board.

        And if a dead robot could write you a letter, what
        would you expect to be reading:




        AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
        BBBBBBBBBBBB
        CCCCCCC
        DDDD
        EE
        F
        FFF




        --- MAILER-DAEMON@... wrote:

        > Hi. This is the qmail-send program at yahoo.com.
        > I'm afraid I wasn't able to deliver your message to
        > the following addresses.
        > This is a permanent error; I've given up. Sorry it
        > didn't work out.
        >
        > <mailerdaemon@...>:
        > Sorry, I couldn't find a mail exchanger or IP
        > address. (#5.4.4)
        >
        > --- Below this line is a copy of the message.
        >
        > Return-Path: <zero_mailer_account@...>
        > Received: (qmail 3831 invoked by uid 60001); 22 Aug
        > 2005 21:47:57 -0000
        > DomainKey-Signature: a=rsa-sha1; q=dns; c=nofws;
        > s=s1024; d=yahoo.com;
        >
        >
        h=Message-ID:Received:Date:From:To:MIME-Version:Content-Type:Content-Transfer-Encoding;
        >
        >
        b=JuvrxJuyTPzgwnSimC0uES0TAz/1G1t4OhictTu5NnMkEPo+RlgFG067CdfN0XtSnuP8KGwnZStqrD8j2FStiaPWFs9fdG2e380PR25bCON31LnEPT6eH1rFTHlY0WPzyu97K0CZULHs1UAex+OhG2PZWUe38UXAQMhvVb9UzVQ=
        > ;
        > Message-ID:
        >
        <20050822214757.3829.qmail@...>
        > Received: from [82.195.239.20] by
        > web35213.mail.mud.yahoo.com via HTTP; Mon, 22 Aug
        > 2005 14:47:57 PDT
        > Date: Mon, 22 Aug 2005 14:47:57 -0700 (PDT)
        > From: Mailer Accountent
        > <zero_mailer_account@...>
        > To: mailerdaemon@...
        > MIME-Version: 1.0
        > Content-Type: text/plain; charset=iso-8859-1
        > Content-Transfer-Encoding: 8bit
        >
        > Stop!
        > Read no further!
        >
        > qplastix
        >
        >
        > Pause:
        >
        > Qwertzuiopasdfghjklyxcvbnm
        >
        > Qertzuiopasdfghjklyxcvbnmw
        >
        > Qrtzuiopasdfghjklyxcvbnmwe
        >
        > Qtzuiopasdfghjklyxcvbnmwert
        >
        > If letters were numbers and if pi was an endless
        > accumulation of letters from a to z with a space in
        > between, then you would eventually discover a
        > sequence
        > of letters which looked to your eye as the exact
        > phrase below.
        >
        >
        > I am the number of Pi. The number system I am using
        > includes the letters a to z including the space
        > zero,
        > comma and period.
        >
        > I am the number of Pi. You are looking at an
        > infinite
        > arrangement of letters which are symbols for numbers
        > which are symbols to describe how to calculate the
        > circumference of a circle.
        >
        > I am this circle, and I am calculating myself.
        >
        > I am the number of Pi.
        >
        >
        >
        >
        >
        >
        >
        Afhhglkah�lgkah�lkghsdjghksljhgkjdsghslkjfdghwurhtwoeutzoiwrtzoidhfsljvnlkm,okmijnuhbzgvtfcrdxesywayqyesxrdcftvzgbuhnijmokmoirutqpurztoiughakjlflhglkfjvbm,ynv,mfghyqaqaxwsxdecrgbzhnukmoplbfvufhuedhnsiokmxoswkxcmirufvbtugznijcmodkmokcmdiojvnrgufhnvhtbvztghvurfjncdejmcdokxwopsl,xpwl,dcoekfmvirjgnigjbrmgkomfoke,efdoklc,eofkvmgiubngzbuthznbirjfmcoed,cpld,coekrmvitunuhbnhujfnviewdkmxows,xpql,ypl,pla,ql,yowkmxwimdcijdncufrhnvuhrgbvuhtgbnuthgnviejcmowkdmxpsl,xpql,sypls,xokmricjnritjvnritjbnitbnfjinvijfmnivjnrhunuzhgbzhbedtxgfvrdcesyxewdscxwfcvdcgevtzgrfvbr7zhgbvuthgnbuitjhznizkmjuouk,jmolj,noz,bplhnmozkhmnzohknmijnvuhbudhcbiwdcjknrivfbutbhiedcnnejkcmocmfgnjklsjfhgueidmejvbrijnvoefnbjrhwkjhfwkjghwrkljwghrouitzofhskdjghkvbxcm,nvbmndfbgjkhgkejhtieruthkgjefhgkjsfhgkjshfgkherotuizeriutwzeurtztdfshgfdjhdgbcmcxnbvmxnbvmxcnvbmxcnvbmxcnvbksjfhkdjfghdkfjghkerutzieurtzieurtzieurtzidfughkdfjghkdfjghdkfjghxcvmnxbcvmnxcvbmxcnvbkjsfghkjdfhgkjhdfgkjhdfgoiuertoiuertoiuertoiuertoiuqweiuzqiweuziewurtzuwezrtuz
        >
        wteruztweruztsdfjzgsdfjhgsdfjhgcvmnbcyvm,nbycmvnbxcvmnbasdfkjhasdkjhasdkjhasdkjherizewriuzwrtiuzertoiuertpoietpoiertpoiertpofisdgjklfghkdjghkdjfghkdjghkdjfghkdjfghkdjfgh
        >
        >
        > STOP! Look no further!
        >
        > Pause.
        >
        > Focus your mind attention and the attention of your
        > eyes at the words below.
        >
        > Stop!
        >
        > Look no further!
        >
        >
        Ksdfkjsdhfkjwheriouwezriuwrztieurztieurhtkejhgkjdfhvkdjghkdjfhgkdjfghkdjfghdkjfhnk,cvmbn,xmnb,xmcvnb,xcbvmjxcnvbjyxhcfhjagsdfhagsdfahsgdfhqgwefqzwterqzwterqzwterqzwtrasdhgasfdhagsdfhasgdfahsdgfyxcnbyxvcnbyxvcnybxcvnbvsdfkjhfgkjhdfkgjhdfgkjhtezoiurtzoiurtzoiurtzoiufghlkjfghlkjfhlkfhpoirupoitzupoitzuptoigfhlkjfhlkfjhlkfjhlkjcvb,mncvbm,ncbvmnbcvnbcvmgbdfjkghsdfkgfgjhgjrhtgiurtzierutzieurtzieurtzieurtzieurtziuerztieurtziuerztieurztieurztieurtzieurtzieurztiuerztiuerztiuezrtiuerztiuerztiuezrtiuzertiuzertiuzertiuzertiuezrtiuzertiuezrtiuezrtiuezrtiuezrtiuezrtiuzertiuzertiuzertiuezrtiuezrtiuerztiuertzieurtzieurtzieurtziuertzieurztiuerztiuezrtiuzeriutzeirutzierutzieurtzieurtzieurtzeirutzerituzeirutzeirutzeirutzieurtzierutzieurtzieurztieurztiuerztiuerztiuerztiuezrtiuezrtiuezrtiuzertuizfgkjdhfgkjhdfgkjhdfgkjhdfgkjhdfgkjhdfkgjhdfkgjhdfgkjdhfgkjdfhgkjdfhgkjdfghkjdfghkdjfghkdjfghkdjfghkjdfhgpoitzpoirtzpoirtzpoirtzpoirtzpoirtzopirpoziprotziportziportziprotzipoeritpoeritpeoriteprotiweporipoweirpowier
        >
        powierpoiqwepoiqwepoiqwepoiqweoiqwueoiquweoiquweoiquweoiquweiuwezriuzweriuzweriuzqweuztqweuztqweuztqwuez
        > t
        >
        qwztrqwzetrqzwterzqtwerahsgdfjasdgfjasgdjhasdgsjghkjdfghkjdfghkjdgflkxjblkxjcblkjvblkjcvblkjcvblkjcvbjcvblkjcvblkjcvbkljcvblkjcvbmnbcxmvnbyxcmnbyxcmnbyxcmbnyxcmnbadfkjhsdfkljshdfkjhsdfkjhsdfkjhsdfkjhsdfkjhsdfkjhsdfkjhweiuzweriuzweriuzweriuzweriuzweiruzweiruzweriuzrtoiudhgoiughfjijnijonijnijnijnijnijnijnijnijnijnijnijnijnhubuhbuhbuhbuhbuhbuhbzgvzgvzgvzgvzgvzgvzgvtfctfctfctfctfcrdxrdxrdxrdxrdxesyesyesyesyesyesyesyesyesyesyqayqyqayqayqayqayqayqayqokaymqoakymqoymkqokaymqoymkoqkymoqakymqoykmwixjnwisjxnwisjxnwijxnwijxniwjxnwijxsnwijxneucdhbeudhcbeudhcbeudbhcuedhcbuecdhbeucdhbeudhcbzgwsxvzgwsvxzwgsxvzwgsxvzwgsvxzwgsvxzgwsvxzwgsxvqtyctqfacytqfyctqfyctqfyctacytfqcaytqfcaywszxgvwszgxvwzsgxvwzsgvxzwgvsxzwgsvxwzgsxvzwgsxvedchubeduhcbeudhcbeudhbcudbhcuebhdcuedhbcuecdbirjvnirjvfnirvfnirjvfnrijvnirvfnirjvfnrijvfnoktgmboktgmbotkgmboktgmboktmgboktgmbotkgmboktgmbokmzhnokmzhnokmzhnokmzhoknmzhoknmzhonkmzhokmnokmgijntgibjntigjnbitjgnboktgmbotkmotkgmbotkgmbpoipoeritpoertipoertipeotilskdjslkjsdlfkjsdlfkjsd
        >
        lkfjsdlkfjsldkjflsdjflskjdflskdjflksdjflskdjflksdjflksjdflkjfgjdhfgjhfgklsdjfhglkjfdsghireuotzwoeirutzweortuizweortuizwertoiuzwertoiuwezrtoiwuerztowieurztwoieurtzwoieutzwioeurtzwoeiurtzwoiurtzwoeituzu
        > iz iutzwrituozwuioz r twiztiutz
        > iuzwieruzweiroutzeiorwutzkhja kfh kj
        > kjahaksldjhaskljdfhaskldjhfaksljdfh
        >
        akjfhasdkljfhasdlkjfhlkadjfhlaskjdfhkaldsfhadhskfhjasdfksdhklhkasdfhasdfkasdfhkhkdfashasdfkasdfhkkasdfkasdfhksdafasdfkjasdkfkasdfkjasdfksdafjksdfa
        > kasdf kljh asdf
        > kjahdfjhasdfasdkfjhasdkfjhasdlkfjahjkasdhfklasdjfh
        > askldjfh asdkljfh skdafjlhjkh jkfhklasdjfh jkasf
        > haksjdf haskljdfhlkasjdf hskadjf hskjdf hkasljdf
        > hskajdfhkjasdfh sakldjf hkasjdf hkasljdfh ksjlf
        > hklasjdfh kasldjfh lkjadfh ksdjalfh ajksd hfkajsdfh
        > lkajsdfh oqwepruoiwu qeropiuerpoiqwuer poiqur qoiru
        > qopieru qopiweru qopir ukom ookm kom jin ijn hu buhb
        > gzv gzv ftc tfc rdx rdx qay qaywsx wsxed cedc rfv
        > tgb
        > zhbhn u mjik ol p
        >
        >
        >
        >
        > Mir_ology is the art teaching yourself.
        >
        >
        > I am the number of Pi.
        >
        > The letters and words you are reading are part of an
        > infinite chain of letters, break.
        >
        > Iuertzieurztierutzeirutzeirutzeirutzierutz
        >
        > Sometimes over very long periods the same symbols
        > are
        > repeating themselves.
        >
        > For example as in
        >
        000000000000000000000000000003.1..........................
        >
        > If this event occurs, you can start back at the top
        > and jump from one paragraph to another because
        > repetitions are normal.
        >
        > To explain you this number from the beginning
        >
        oiuotiuerotiuerotiuerotiuerotiueorgijdflgkjdlfkgjldkfjgoeiurtzoeijhldknbkdvnbhldkgholeirjghopeiuzeoiuzeoiuzroiuzroiuzroiuhdoglhjdlkjhdlkfjglsdkjfoieruwoetzwiouztwiudhfskdjhngldfnhlkgjhlrituzorituzoertikhjlekfjhoefuigoeiruzoitjrhlkjfhlkdjflhdfiguoieurozieuzporiutpeioupoiuzopztiouwqzirtquetzruqwzetruwzetruwzetruweztruwezrtwuehgrjkwdhfksjdhfirgoeirutoiwueroitjlkwjlzkjflkjsdoiuofihjlgkhjl�gkhjlfgkjhsgh
        >
        >
        > Start making sense, arranging letters and symbols in
        > a
        > certain order which are making sense is a
        > coincidence,
        > is a
        >
        coincidnecevevebenemenennncncnencncencnecnencnencnencnencencnencnencnencencnencnenennnndnnendcnedncnedcnedncnedcnednncnedncnedncnedncdncnndncnedcnendcbdnbcnedbcehdgjehdgjhdgchedgcuztudztuzdtgvuzegvjkehfbvkjfhnljkwhjlkjlihjtiohjltkhjlrkjghoirtjoidhuiugduqwzfeuqwzgkqsjhbkjnv,mcn,vmxn,hdfnkjgndk
        >
        fnvkdjfhgehrgioeurhglojglsdjhkdfgiuseziuwehfkwjehkjwhetiuwrztiefhgksjdnbfkjsdhfkwueztiuwrthiwejrhgkdjhfkldjfhnijnuhjrvbuzrhtvbzgrfcbedhuxisjwincrzbvfurbzvehfbvehrbgjehrhbnv
        > mmamamamamamamammkkkkkkkkiingngnt senesessessssss
        >
        > Am iii mmmaakkingn sensneennsnsnsn
        >
        > Am I making sense, sense, sense, sense, sense,
        >
        > This is a repetition, this is no repetition, no
        > repetition, no repetition,
        >
        jhskkuuezukjkvmnkjhkjhfgjhgjzruzwerwkjhkjhkgjhrueirutzeijhkjv
        > kh kjfh hk k kh kfh kn,mn n v ouoiwe lj wlwuroi
        >
        > lm okm ok ijn ijn uh bu hb zgv zgv tfc tfc
        > rcrcrdxedxs
        > y ay wex edxc rc rfc tv zg vzg bzuhbu h uijn ijni m
        > ikmok mo kmionnu hb z gv g v v tfv ft ctfcr crd cx
        > drx rdcft fcrf crdfc tfz gb uhbijbnivb ugv z gvc
        > zcfc
        > tfctcd xr dx rdx rdx rd xctfczgv g v zgv zgvhbhb
        > njhbnuj nu b hb zgv tv tfc r cr dcx rfc tgv zb zhb
        > hub uh uhbuhn ujn jn ijni m okm om okm ikn ij nij
        > niu
        > bnuh buzh b zg vtz gvtf cvtf c r dc erdx esx wsy
        > wesxe dxr ct zvz gvb zubu hbu h buh b uhbu hb uhbn
        > ef
        > grbrgbrgbrg rgb tgb t n t b tgnhnzmjmumim m l mi
        > jm
        > j n h nz hn h btg bt gbt gb gtb tgb vfr f
        > vfvdcdesxx
        > qwsx s s cg z cd v h j k e t ui o n v xd r
        > f
        > z u n g t u n i kl m o l p o k jn u h z g b t f re
        > d
        > c f r t fv g z h b j i n m k o l p o k m n j i u h b
        > g
        > z t f v c d r es s x w wd d v f r g b h zt g
        > h
        > n b g h j u zu z h j mn m k i o l l p o k j u z
        >
        > h g t r f f d e er r v b g t z h n j i i k k m
        > m
        > n n j j h h g z t t f rdfguhg uh gu g uhguhg uhgu
        > gug ugh gh g h g hgg gg m j j h h
        > j
        > j uu j h rrtt g g z z h h gg
        >
        > wed d f e e r f f t z z h h u ui i
        > j
        > uu h gt rt n j gh gh g q w we r t
        > g
        > h h j i i u z z tgb x o km fh ekjfgbkgvnsmf
        > gfbd fbdfbn.............
        >
        === message truncated ===
      Your message has been successfully submitted and would be delivered to recipients shortly.